PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00163.1.g00280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 537aa    MW: 58717.6 Da    PI: 10.8719
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00163.1.g00280.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-17196243148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEde+lv +++ +G g+W++ ++  g+ R++k+c++rw +yl
  Zmw_sc00163.1.g00280.1.am.mk 196 KGAWTKEEDERLVAYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWMNYL 243
                                   79******************************99************97 PP

2Myb_DNA-binding52.88.9e-17249293147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg++T +Edel+++++  lG++ W++Ia  ++ gRt++++k++w+++
  Zmw_sc00163.1.g00280.1.am.mk 249 RGNFTDDEDELIIRLHSVLGNK-WSLIAGQLP-GRTDNEIKNYWNTH 293
                                   89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-23187246IPR009057Homeodomain-like
PROSITE profilePS5129417.186191243IPR017930Myb domain
SMARTSM007177.6E-14195245IPR001005SANT/Myb domain
SuperFamilySSF466898.44E-29195290IPR009057Homeodomain-like
PfamPF002494.2E-15196243IPR001005SANT/Myb domain
CDDcd001671.08E-10198243No hitNo description
PROSITE profilePS5129427.722244298IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.0E-27247298IPR009057Homeodomain-like
SMARTSM007174.1E-16248296IPR001005SANT/Myb domain
PfamPF002491.0E-14249293IPR001005SANT/Myb domain
CDDcd001672.27E-11251294No hitNo description
Gene3DG3DSA:1.10.10.601.4E-7313347IPR009057Homeodomain-like
PROSITE profilePS500903.915314330IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MPAAEPHTVS SSSGLLSSLG YAAEFFRVLS SIFVTDSTLH APTSPPLLSS NSSQAAPQRQ  60
GLSTKRKCRC RTRTAAEVVR QDTRAPLHST PRRAPHRNHR QRQPLLLPDR SQPNSNPPAH  120
VKLARKTPSG RSIYRQIEKP GRARAPYIRA PRASSETGNL CSLARAPRGP AGSQACDCER  180
ESMGRSPCCE KAHTNKGAWT KEEDERLVAY IRAHGEGCWR SLPKAAGLLR CGKSCRLRWM  240
NYLRPNLKRG NFTDDEDELI IRLHSVLGNK WSLIAGQLPG RTDNEIKNYW NTHIKRKLLA  300
RGVDPQTHRP LSALPGRTDN EIKNYWNTHI KRKLLARGVD PQTHRPLSAV SAAPRAAAAV  360
TTALLPPVMT VPAAPTFAAR AVESSSDDGG RSSNSSSSGG STGEPPRCPD LNLDLSVGLP  420
VVDTPTSPRP VCLCYRLGLR DGQACSCQGT QRFTIQSVLQ EEQDEIAFKR WRPASRGGRT  480
WMRVATPDKP ATDAVSGCGA MLRGGREERI WRHEIGSRAV AGGGGWWTAA VTRLVSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-271962987108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638107.11e-108PREDICTED: myb-related protein 308
TrEMBLF2DXW01e-109F2DXW0_HORVD; Predicted protein
TrEMBLQ069441e-109Q06944_HORVU; MybHv5
STRINGMLOC_71041.11e-108(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4434833